PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G16010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 548aa    MW: 59179.3 Da    PI: 6.3772
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G16010.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.9e-31122175255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  OPUNC06G16010.1 122 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 175
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.601118178IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-29118176IPR009057Homeodomain-like
SuperFamilySSF466895.55E-14121176IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-22122177IPR006447Myb domain, plants
PfamPF002499.7E-9123174IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MGEVKEKEVV EIFEHDHDKI RSPENSVPLP AMVLDLNEGF GEGSEEGEVG EDGDEEDDDD  60
DDDDEDGGST SEVAGGGRSS SSTNHNSGSD KDHDMNSSSS KADGGGGDRV PTVRQYNRSK  120
LPRLRWTPDL HMAFVHAVER LGGQERATPK LVLQMMNVRG LSIAHVKSHL QMYRSKKLDH  180
ESGHERGAIS SVFSPMEFHM RRGDHRFHHH DMFFQRAAAC AGAGGSPFSS RQLHENGGGF  240
FASRNPGLPE SSRLYGLFQR RQQAPMQTFD FKNCNSFRNQ EWAFNQQQAA ARATGAVNDH  300
GPAKGLIHEM IFRNEGKPTS HLFDVRDAIA STRMTSATRG AAAAAAAHRL DGAGKAGNFD  360
WIGSSSRPLT RTMSAAATMG DHHLRWRGVA GSGNTSASSD PVIASEALGS LLERAKTKAT  420
DAMHLETPAK MMMTTTAAEE EEEINGRKPD LQLSLSPNAG DHTGRSASKK RKFLTEQEVD  480
SDTQQQLPLT LSLSLRGGGG NGGGECRGGE AGRLEEEMTG SSSSKKAALG LSTLDLTMSI  540
KALEKIKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0736060.0AK073606.1 Oryza sativa Japonica Group cDNA clone:J033048N17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641454.10.0PREDICTED: uncharacterized protein LOC4341235 isoform X2
TrEMBLA0A0E0LCE60.0A0A0E0LCE6_ORYPU; Uncharacterized protein
STRINGORGLA06G0148100.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-34G2-like family protein